PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0080s0480.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 281aa    MW: 32544.5 Da    PI: 8.9215
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0080s0480.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.61.8e-47111373128
                     NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                             pGfrFhPt+eel+++yLk+ v g+k++l +vi  ++iy+++P++Lp   k +e+ewyfF++rd+k+++g r+nr+t++g+Wkatg+d
  SapurV1A.0080s0480.1.p  11 PGFRFHPTEEELLDFYLKNMVFGRKMRL-DVIGYLNIYRHDPSELPGLSKVGEREWYFFVPRDRKQSSGGRPNRTTQNGFWKATGSD 96 
                             9**************************9.99***************8778899********************************** PP

                     NAM  90 kevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             ++++s    ++ +g++ktLvfykgrap+g+ktdW+m+eyrl
  SapurV1A.0080s0480.1.p  97 RKIVSLsdPKRMIGMRKTLVFYKGRAPRGSKTDWIMNEYRL 137
                             ***997666778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100553.2659156IPR003441NAC domain
SuperFamilySSF1019414.97E-5510156IPR003441NAC domain
PfamPF023651.5E-2511137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDEMPLQLDL PGFRFHPTEE ELLDFYLKNM VFGRKMRLDV IGYLNIYRHD PSELPGLSKV  60
GEREWYFFVP RDRKQSSGGR PNRTTQNGFW KATGSDRKIV SLSDPKRMIG MRKTLVFYKG  120
RAPRGSKTDW IMNEYRLPDY SSPLPKDIVL CKIYRKATSL KVLEQRATME EEMRAIHASA  180
SSSSLDTMSF CSQLEEPVLP PVLPSQHLVF KKEIEETDII RYEQPKEIKG STLQLPLGEG  240
KLPQLQVPSK WSMEWNQDPI WSLNSPWLQN LIPYADVLNF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-441115617168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2248830.0CU224883.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305547.10.0no apical meristem family protein
TrEMBLB9H1P60.0B9H1P6_POPTR; No apical meristem family protein
STRINGPOPTR_0004s18860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62143251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-106NAC domain containing protein 36